Recombinant Mouse TNC Protein (1884-2099 aa), His-tagged
Cat.No. : | TNC-2566M |
Product Overview : | Recombinant Mouse TNC Protein (1884-2099 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 1884-2099 aa |
Description : | Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3 and ITGAV:ITGB6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.8 kDa |
AA Sequence : | GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Tnc tenascin C [ Mus musculus ] |
Official Symbol | TNC |
Synonyms | TNC; tenascin C; tenascin; hexabrachion; TN; Hxb; Ten; TN-C; AI528729; cytotactin; tenascin-C; C130033P17Rik; MGC144208; MGC144209; |
Gene ID | 21923 |
mRNA Refseq | NM_011607 |
Protein Refseq | NP_035737 |
UniProt ID | Q80YX1 |
◆ Recombinant Proteins | ||
TNC-735H | Recombinant Human TNC protein(Gly23-Ser621), His-tagged | +Inquiry |
TNC-8548Z | Recombinant Zebrafish TNC | +Inquiry |
Tnc-2051M | Recombinant Mouse Tnc protein, His-tagged | +Inquiry |
TNC-301211H | Recombinant Human TNC protein, GST-tagged | +Inquiry |
TNC-32H | Recombinant Human TNC Partial Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TNC-50H | Native Human Tenascin C | +Inquiry |
TNC-08H | Native Human TNC Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNC Products
Required fields are marked with *
My Review for All TNC Products
Required fields are marked with *
0
Inquiry Basket