Recombinant Mouse Tmprss4 Protein, His/SUMO-tagged

• Cat.No.: Tmprss4-3309M
• Product Overview: Recombinant Mouse Tmprss4(52-435aa) fused with His/SUMO tag at the N-terminus was produced in E. coli.

Specification

• Source: E. coli
• Species: Mouse
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 57.8kDa
• Protein length: 52-435aa
• AA sequence: KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
  Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
  Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigradefor up to one week.

Gene Information

• Gene Name: Tmprss4 transmembrane protease, serine 4 [ Mus musculus ]
• Official Symbol: Tmprss4
• Synonyms: TMPRSS4; transmembrane protease, serine 4; transmembrane protease serine 4; channel-activating protease 2; membrane-type serine protease 2; mCAP2; MGC29209
• Gene ID: 214523
• mRNA Refseq: NM_145403
• Protein Refseq: NP_663378
• UniProt ID: Q8VCA5