Recombinant Human TMPRSS4 protein, His&Myc-tagged

• Cat.No.: TMPRSS4-674H
• Product Overview: Recombinant Human TMPRSS4 protein(Q9NRS4)(54-437aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His&Myc
• Protein length: 54-437a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 49.8 kDa
• AASequence: KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: TMPRSS4 transmembrane protease, serine 4 [ Homo sapiens ]
• Official Symbol: TMPRSS4
• Synonyms: TMPRSS4; transmembrane protease, serine 4; transmembrane protease serine 4; membrane type serine protease 2; MT SP2; TMPRSS3; transmembrane serine protease 3; type II membrane serine protease; channel-activating protease 2; membrane-type serine protease 2; CAPH2; MT-SP2
• Gene ID: 56649
• mRNA Refseq: NM_001083947
• Protein Refseq: NP_001077416
• MIM: 606565
• UniProt ID: Q9NRS4