Recombinant Mouse Tfam protein(43-243aa), His&Myc-tagged
Cat.No. : | Tfam-2111M |
Product Overview : | Recombinant Mouse Tfam protein(P40630)(43-243aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 43-243aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SSMGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH |
Gene Name | Tfam transcription factor A, mitochondrial [ Mus musculus ] |
Official Symbol | Tfam |
Synonyms | TFAM; transcription factor A, mitochondrial; TS-HMG; testis-specific HMG-box protein m-tsHMG; testis-specific high mobility group protein; Hmgts; mtTFA; tsHMG; AI661103; |
Gene ID | 21780 |
mRNA Refseq | NM_009360 |
Protein Refseq | NP_033386 |
◆ Recombinant Proteins | ||
Tfam-2111M | Recombinant Mouse Tfam protein(43-243aa), His&Myc-tagged | +Inquiry |
TFAM-6024R | Recombinant Rat TFAM Protein | +Inquiry |
TFAM-6414H | Recombinant Human TFAM Protein (Ser43-Cys246), N-GST tagged | +Inquiry |
TFAM-5683R | Recombinant Rat TFAM Protein, His (Fc)-Avi-tagged | +Inquiry |
TFAM-7866H | Recombinant Human TFAM protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFAM-1765HCL | Recombinant Human TFAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tfam Products
Required fields are marked with *
My Review for All Tfam Products
Required fields are marked with *
0
Inquiry Basket