Recombinant Mouse Tfam protein(43-243aa), His&Myc-tagged

• Cat.No.: Tfam-2111M
• Product Overview: Recombinant Mouse Tfam protein(P40630)(43-243aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: N-His&C-Myc
• ProteinLength: 43-243aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.9 kDa
• AASequence: SSMGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Tfam transcription factor A, mitochondrial [ Mus musculus ]
• Official Symbol: Tfam
• Synonyms: TFAM; transcription factor A, mitochondrial; TS-HMG; testis-specific HMG-box protein m-tsHMG; testis-specific high mobility group protein; Hmgts; mtTFA; tsHMG; AI661103
• Gene ID: 21780
• mRNA Refseq: NM_009360
• Protein Refseq: NP_033386