Recombinant Human TFAM protein, His-tagged

• Cat.No.: TFAM-7866H
• Product Overview: Recombinant Human TFAM protein(Q00059)(43-246aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 43-246aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.5 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC

Gene Information

• Gene Name: TFAM transcription factor A, mitochondrial [ Homo sapiens ]
• Official Symbol: TFAM
• Synonyms: TFAM; transcription factor A, mitochondrial; TCF6, TCF6L2; TCF-6; transcription factor 6; mitochondrial transcription factor 1; mitochondrial transcription factor A; Transcription factor 6-like 2 (mitochondrial transcription factor); TCF6; MtTF1; mtTFA; TCF6L1; TCF6L2; TCF6L3
• Gene ID: 7019
• mRNA Refseq: NM_003201
• Protein Refseq: NP_003192
• MIM: 600438
• UniProt ID: Q00059