Recombinant Mouse Stc2 protein

Cat.No. : Stc2-4574M
Product Overview : Recombinant Mouse Stc2 protein(O88452)(25-296aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
ProteinLength : 25-296aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 30.1 kDa
AA Sequence : TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Stc2 stanniocalcin 2 [ Mus musculus ]
Official Symbol Stc2
Synonyms STC2; stanniocalcin 2; stanniocalcin-2; STC-2; Stc2l; mustc2; AW125853;
Gene ID 20856
mRNA Refseq NM_011491
Protein Refseq NP_035621

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Stc2 Products

Required fields are marked with *

My Review for All Stc2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon