Recombinant Mouse Stc2 protein

• Cat.No.: Stc2-4574M
• Product Overview: Recombinant Mouse Stc2 protein(O88452)(25-296aa) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• ProteinLength: 25-296aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.1 kDa
• AA Sequence: TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Stc2 stanniocalcin 2 [ Mus musculus ]
• Official Symbol: Stc2
• Synonyms: STC2; stanniocalcin 2; stanniocalcin-2; STC-2; Stc2l; mustc2; AW125853
• Gene ID: 20856
• mRNA Refseq: NM_011491
• Protein Refseq: NP_035621