Recombinant Mouse Mif protein

• Cat.No.: Mif-5189M
• Product Overview: Recombinant Mouse Mif protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 115
• Description: Macrophage migration inhibitory factor (MIF or MMIF), also named as glycosylation-inhibiting factor (GIF), L-dopachrome isomerase, or phenylpyruvate tautomerase, is a protein encoded by the MIF gene. It is released from white blood cells by bacterial antigen stimulation to trigger an acute immune response, or by glucocorticoids to counter-act the inhibitory effects of glucocorticoids on immune system. MIF is a homotrimer of which each subunit contains 115 amino acids. As mentioned above, MIF is involved in the innate immune response to bacterial pathogens and counter-acts the anti-inflammatory activity of glucocorticoids. Furthermore, it also plays a role as mediator in regulating the function of macrophages in host defense and has phenylpyruvate tautomerase and dopachrome tautomerase activity in vitro. Mouse MIF is active on human cells, while human MIF is active on mouse cells. Mouse MIF is 99%, 84%, 90%, and 90% a.a. identical to rat, porcine, bovine and human MIF, respectively.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 1 mM DTT.
• Molecular Mass: Approximately 12.5 kDa, a single non-glycosylated polypeptide chain containing 115 amino acids.
• AA Sequence: MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
• Endotoxin: Less than 1 EU/µg of rMuMIF as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Mif
• Official Symbol: Mif
• Synonyms: MIF; macrophage migration inhibitory factor; DER6; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; glycosylation-inhibiting factor; delayed early response protein 6; GIF; Glif; MGC107654
• Gene ID: 17319
• mRNA Refseq: NM_010798
• Protein Refseq: NP_034928
• UniProt ID: P34884