Active Recombinant Human MIF Protein, His-tagged

• Cat.No.: MIF-736H
• Product Overview: Recombinant Human MIF fused with His tag at N-terminal was expressed in Hi-5 Insect cells.

Specification

• Species: Human
• Source: Hi-5 Insect Cells
• Tag: His
• Description: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
• Bio-activity: Determined by its ability to inhibit monocyte migration.
• Molecular Mass: 15 kDa
• AA Sequence: HHHHHHHHAMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: MIF macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Homo sapiens ]
• Official Symbol: MIF
• Synonyms: MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF
• Gene ID: 4282
• mRNA Refseq: NM_002415
• Protein Refseq: NP_002406
• MIM: 153620
• UniProt ID: P14174