Recombinant Mouse Lta protein, His-tagged

• Cat.No.: Lta-4368M
• Product Overview: Recombinant Mouse Lta protein(P09225)(34-202aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 34-202aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.8 kDa
• AA Sequence: LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Lta lymphotoxin A [ Mus musculus ]
• Official Symbol: Lta
• Synonyms: LTA; lymphotoxin A; lymphotoxin-alpha; TNF beta; lymphotoxin alpha; tumor necrosis factor ligand superfamily member 1; LT; Ltx; Tnfb; LT[a]; LT-[a]; TNFSF1; hlb382; LTalpha; Tnfsf1b; LT-alpha; TNF-beta; MGC117668
• Gene ID: 16992
• mRNA Refseq: NM_010735
• Protein Refseq: NP_034865