Recombinant Mouse Il5ra Protein, His-tagged

• Cat.No.: Il5ra-7244M
• Product Overview: Recombinant Mouse Il5ra Protein with a His tag.

Specification

• Species: Mouse
• Tag: His
• Protein Length: 18-339
• Description: This is the receptor for interleukin-5. The alpha chain binds to IL5.
• Form: Liquid
• Molecular Mass: 37.8 kDa
• AA Sequence: DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHLEHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Il5ra interleukin 5 receptor, alpha [ Mus musculus (house mouse) ]
• Official Symbol: Il5ra
• Synonyms: Il5ra; interleukin 5 receptor, alpha; I; Il5r; CD125; CDw125; interleukin-5 receptor subunit alpha; IL-5 receptor alpha chain; IL-5 receptor subunit alpha; IL-5R subunit alpha
• Gene ID: 16192
• mRNA Refseq: NM_008370
• Protein Refseq: NP_032396
• UniProt ID: P21183