Recombinant Cynomolgus IL5RA Protein, His tagged

• Cat.No.: IL5RA-620C
• Product Overview: Recombinant Cynomolgus IL5RA Protein with His tag was expressed in HEK293T.

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: His
• Protein Length: 21-340 aa
• Description: The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Several alternatively spliced transcript variants encoding four distinct isoforms have been reported.
• Molecular Mass: 38 kDa
• AA Sequence: DLLPDDKISLLPPVNFTIKVTGLAQVLLRWEPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQKDHSLLASSWASAELHAPPGSPGTSVVNLTCTTNTTADNYSYLRPYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDSMGRNIACWFPRTFIHSRGRDWLAVLVNGSSKHSAIKPFDQLFALHAIDQINPPLNVTAEIKGTRLSIQWEKPVSAFPIHCFDYEVKIHNARNGYLQIEKMMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGKDEHKPLRHHHHHHHHHH
• Endotoxin: <1 EU/μg by LAL
• Purity: > 80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 0.25 mg/mL by BCA

Gene Information

• Gene Name: IL5RA interleukin 5 receptor subunit alpha [ Homo sapiens (human) ]
• Official Symbol: IL5RA
• Synonyms: IL5RA; interleukin 5 receptor subunit alpha; IL5R; CD125; CDw125; HSIL5R3; interleukin-5 receptor subunit alpha; CD125 antigen; IL-5 receptor subunit alpha; IL-5R subunit alpha; interleukin 5 receptor type 3; interleukin 5 receptor, alpha; interleukin-5 receptor alpha chain
• Gene ID: 3568
• mRNA Refseq: NM_000564
• Protein Refseq: NP_000555
• MIM: 147851
• UniProt ID: Q01344