Recombinant Mouse Il1f5 protein

• Cat.No.: Il1f5-553M
• Product Overview: Recombinant Mouse Il1f5 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 154
• Description: Interleukin-36 receptor antagonist (IL-36RA) is a secreted protein which belongs to the interleukin 1 cytokine family (IL-1 family) and it is predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. IL-36RA has been reported to antagonize the biological activity of IL-36α (IL-1F6), IL-36β (IL-1F8), and IL-36γ (IL-1F9). Furthermore, it could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1). In addition, The receptor for IL-36RA has not been positively identified. Indirect evidence suggests it is IL-1Rrp2. Recombinant murine interleukin-36 RA contains 154 amino acid residues and it shares 91 % a.a. sequence identity with human IL-36RA.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Measured by its ability to inhibit IL-36γ induced IL-6 production by human PBMCs.
• Molecular Mass: Approximately 16.9 kDa, a single non-glycosylated polypeptide chain containing 154 amino acids.
• AA Sequence: VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
• Endotoxin: Less than 1 EU/µg of rMuIL-36RA as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il1f5
• Official Symbol: Il1f5
• Synonyms: IL1F5; interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; IL-1F5; IL-1L1; IL-1HY1; IL-1 delta; interleukin-1 HY1; interleukin-1 delta; interleukin-1 homolog 3; interleukin-1-like protein 1; interleukin-1 family member 5; interleukin 1 receptor antagonist homolog 1; IL36RN; Il-1h3; Il1hy1; AI413231; Fil1delta
• Gene ID: 54450
• mRNA Refseq: NM_001146087
• Protein Refseq: NP_001139559
• UniProt ID: Q9QYY1