Active Recombinant Mouse Il36rn Protein, His-Tagged

• Cat.No.: Il36rn-01M
• Product Overview: Recombinant mouse Il36rn Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: As a result of the interaction of IL-36 ligands with the IL-1Rrp2 receptor. Various activities including dendritic cell maturation and activation are induced. IL-36RA can antagonize the NF-κB signaling through binding to the IL-1Rrp2 receptor by either IL-36α, β or γ in a way of preventing the initiation of functional signaling.
• Form: Lyophilized powder
• AA Sequence: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKE
  SKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The ED50 for this effect is <2 μg/mL.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il36rn interleukin 36 receptor antagonist [ Mus musculus (house mouse) ]
• Official Symbol: Il36rn
• Synonyms: Il1f5; If36rn; Il-1h3; Il1hy1; IL-36Ra; Fil1delta
• Gene ID: 54450
• mRNA Refseq: NM_001146087.1
• Protein Refseq: NP_001139559.1
• UniProt ID: Q9JIG2