Recombinant Human IL36RN protein

• Cat.No.: IL36RN-512H
• Product Overview: Recombinant Human IL36RN protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 154
• Description: Interleukin-36 receptor antagonist (IL-36RA) is a secreted protein which belongs to the interleukin 1 cytokine family (IL-1 family) and it is predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. IL-36RA has been reported to antagonize the biological activity of IL-36α (IL-1F6), IL-36β (IL-1F8), and IL-36γ (IL-1F9). Furthermore, it could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1). In addition, The receptor for IL-36RA has not been positively identified. Indirect evidence suggests it is IL-1Rrp2. Recombinant human IL-36 RA contains 154 amino acid residues and it shares 91 % a.a. sequence identity with murine IL-36RA.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-36 beta induced IL-8 secretion by human preadipocytes is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg in the presence of 20 ng/ml of recombinant human IL-36 beta.
• Molecular Mass: Approximately 16.8 kDa, a single non-glycosylated polypeptide chain containing 154 amino acids.
• AA Sequence: VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
• Endotoxin: Less than 1 EU/µg of rHuIL-36RA as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IL36RN
• Official Symbol: IL36RN
• Synonyms: IL36RN; interleukin 36 receptor antagonist; IL1F5, interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; family of interleukin 1 delta; FIL1; FIL1(DELTA); FIL1D; IL 1 related protein 3; IL 1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; interleukin 1 HY1; interleukin 1 receptor antagonist homolog 1; MGC29840; IL-1ra homolog 1; interleukin-1 HY1; IL-1 related protein 3; interleukin-1-like protein 1; family of interleukin 1-delta; IL1F5 (Canonical product IL-1F5a); interleukin 1 family, member 5 (delta); interleukin-1 receptor antagonist homolog 1; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL1F5; PSORP
• Gene ID: 26525
• mRNA Refseq: NM_012275
• Protein Refseq: NP_036407
• MIM: 605507
• UniProt ID: Q9UBH0