Recombinant Mouse Hmgb1 protein(2-215aa), His-tagged

Cat.No. : Hmgb1-5311M
Product Overview : Recombinant Mouse Hmgb1 protein(P63158)(2-215aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 2-215aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.8 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Gene Name Hmgb1 high mobility group box 1 [ Mus musculus ]
Official Symbol Hmgb1
Synonyms HMGB1; high mobility group box 1; high mobility group protein B1; high mobility group protein 1; DEF; p30; Hmg1; HMG-1; SBP-1; amphoterin; MGC103168; MGC103169; MGC117896; MGC117897;
Gene ID 15289
mRNA Refseq NM_010439
Protein Refseq NP_034569

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Hmgb1 Products

Required fields are marked with *

My Review for All Hmgb1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon