Recombinant Mouse Hmgb1 protein(2-215aa), His-tagged

• Cat.No.: Hmgb1-5311M
• Product Overview: Recombinant Mouse Hmgb1 protein(P63158)(2-215aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Product Overview: Recombinant Mouse Hmgb1 protein(P63158)(2-215aa), fused with N-terminal His tag, was expressed in Yeast.
• Source: Yeast
• Species: Mouse
• Tag: His
• Protein length: 2-215aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.8 kDa
• AASequence: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Hmgb1 high mobility group box 1 [ Mus musculus ]
• Official Symbol: Hmgb1
• Synonyms: HMGB1; high mobility group box 1; high mobility group protein B1; high mobility group protein 1; DEF; p30; Hmg1; HMG-1; SBP-1; amphoterin; MGC103168; MGC103169; MGC117896; MGC117897
• Gene ID: 15289
• mRNA Refseq: NM_010439
• Protein Refseq: NP_034569