Recombinant Mouse Gng12 protein, His&Myc-tagged

• Cat.No.: Gng12-7865M
• Product Overview: Recombinant Mouse Gng12 protein(Q9DAS9)(2-69aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 2-69aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 15.0 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SSKTASTNSIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSENPFKDKKTC

Gene Information

• Gene Name: Gng12 guanine nucleotide binding protein (G protein), gamma 12 [ Mus musculus ]
• Official Symbol: Gng12
• Synonyms: GNG12; guanine nucleotide binding protein (G protein), gamma 12; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12; AA536815; AI115529; AI314170; AI842738; 2010305F15Rik
• Gene ID: 14701
• mRNA Refseq: NM_001177556
• Protein Refseq: NP_001171027