Recombinant Full Length Human GNG12 Protein, C-Flag-tagged
Cat.No. : | GNG12-2115HFL |
Product Overview : | Recombinant Full Length Human GNG12 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables PDZ domain binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Located in extracellular exosome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 7.8 kDa |
AA Sequence : | MSSKTASTNNIAQARRTVQQLRLEASIEGIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI IL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Chemokine signaling pathway, MAPK signaling pathway, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | GNG12 G protein subunit gamma 12 [ Homo sapiens (human) ] |
Official Symbol | GNG12 |
Synonyms | HG3A |
Gene ID | 55970 |
mRNA Refseq | NM_018841.6 |
Protein Refseq | NP_061329.3 |
MIM | 615405 |
UniProt ID | Q9UBI6 |
◆ Recombinant Proteins | ||
GNG12-1722R | Recombinant Rhesus Macaque GNG12 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG12-7034M | Recombinant Mouse GNG12 Protein | +Inquiry |
GNG12-1000H | Recombinant Human GNG12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gng12-7865M | Recombinant Mouse Gng12 protein, His&Myc-tagged | +Inquiry |
GNG12-5066H | Recombinant Human GNG12 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG12-5855HCL | Recombinant Human GNG12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNG12 Products
Required fields are marked with *
My Review for All GNG12 Products
Required fields are marked with *
0
Inquiry Basket