Recombinant Full Length Human GNG12 Protein, C-Flag-tagged

Cat.No. : GNG12-2115HFL
Product Overview : Recombinant Full Length Human GNG12 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Enables PDZ domain binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Located in extracellular exosome.
Source : Mammalian cells
Species : Human
Tag : Flag
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 7.8 kDa
AA Sequence : MSSKTASTNNIAQARRTVQQLRLEASIEGIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI IL myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Chemokine signaling pathway, MAPK signaling pathway, Regulation of actin cytoskeleton
Full Length : Full L.
Gene Name GNG12 G protein subunit gamma 12 [ Homo sapiens (human) ]
Official Symbol GNG12
Synonyms HG3A
Gene ID 55970
mRNA Refseq NM_018841.6
Protein Refseq NP_061329.3
MIM 615405
UniProt ID Q9UBI6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GNG12 Products

Required fields are marked with *

My Review for All GNG12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon