Recombinant Mouse FCER1A Full Length Transmembrane protein (24-250 aa), His-SUMO-tagged
Cat.No. : | FCER1A-2710M |
Product Overview : | Recombinant Mouse FCER1A Protein (24-250 aa) is produced by in vitro E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-250aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.7kDa |
AA Sequence : | ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Fcer1a Fc receptor, IgE, high affinity I, alpha polypeptide [ Mus musculus ] |
Official Symbol | FCER1A |
Synonyms | FCER1A; Fc receptor, IgE, high affinity I, alpha polypeptide; high affinity immunoglobulin epsilon receptor subunit alpha; fc-epsilon RI-alpha; igE Fc receptor subunit alpha; FcERI; Fce1a; Fcr-5; fcepsilonri; |
Gene ID | 14125 |
mRNA Refseq | NM_010184 |
Protein Refseq | NP_034314 |
◆ Recombinant Proteins | ||
FCER1A-567H | Recombinant Human FCER1A Protein (Met1-Gln205) | +Inquiry |
Fcer1a-2376M | Recombinant Mouse Fcer1a protein, His-SUMO-tagged | +Inquiry |
FCER1A-2710M | Recombinant Mouse FCER1A Full Length Transmembrane protein (24-250 aa), His-SUMO-tagged | +Inquiry |
FCER1A-1459C | Active Recombinant Cynomolgus FCER1A protein, Fc-tagged | +Inquiry |
FCER1A-1458C | Active Recombinant Cynomolgus FCER1A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCER1A Products
Required fields are marked with *
My Review for All FCER1A Products
Required fields are marked with *
0
Inquiry Basket