Recombinant Mouse Fcer1a protein, His-SUMO-tagged

• Cat.No.: Fcer1a-2376M
• Product Overview: Recombinant Mouse Fcer1a protein(P20489)(24-250aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Mouse
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.7 kDa
• Protein length: 24-250aa
• AA Sequence: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Fcer1a Fc receptor, IgE, high affinity I, alpha polypeptide [ Mus musculus ]
• Official Symbol: Fcer1a
• Synonyms: FCER1A; Fc receptor, IgE, high affinity I, alpha polypeptide; high affinity immunoglobulin epsilon receptor subunit alpha; fc-epsilon RI-alpha; igE Fc receptor subunit alpha; FcERI; Fce1a; Fcr-5; fcepsilonri
• Gene ID: 14125
• mRNA Refseq: NM_010184
• Protein Refseq: NP_034314