Recombinant Mouse DEFB14 Protein (23-67 aa), His-SUMO-tagged

• Cat.No.: DEFB14-1043M
• Product Overview: Recombinant Mouse DEFB14 Protein (23-67 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 23-67 aa
• Description: Has antibacterial activity.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 21.2 kDa
• AA Sequence: FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Defb14 defensin beta 14 [ Mus musculus (house mouse) ]
• Official Symbol: DEFB14
• Synonyms: BD-14
• Gene ID: 244332
• mRNA Refseq: NM_183026
• Protein Refseq: NP_898847
• UniProt ID: Q7TNV9