Recombinant Mouse Col4a1 protein(1445-1669aa), His-tagged

• Cat.No.: Col4a1-821M
• Product Overview: Recombinant Mouse Col4a1 protein(1445-1669aa)(P02463), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Mouse
• Tag: His
• Protein length: 1445-1669aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.8 kDa
• AASequence: GFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Col4a1 collagen, type IV, alpha 1 [ Mus musculus ]
• Official Symbol: Col4a1
• Synonyms: COL4A1; collagen, type IV, alpha 1; collagen alpha-1(IV) chain; Del(8)Bru44H; alpha1(IV) collagen; retinal anterior wiring; procollagen, type IV, alpha 1; Bru; Raw; Svc; Col4a-1; Del(8)44H
• Gene ID: 12826
• mRNA Refseq: NM_009931
• Protein Refseq: NP_034061