Recombinant Mouse CLEC4E Protein (46-214 aa), His-tagged
Cat.No. : | CLEC4E-2057M |
Product Overview : | Recombinant Mouse CLEC4E Protein (46-214 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 46-214 aa |
Description : | C-type lectin that functions as cell-surface receptor for a wide variety of ligands such as damaged cells, fungi and mycobacteria. Plays a role in the recognition of pathogenic fungi, such as Candida albicans. The detection of mycobacteria is via trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid. Specifically recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia. Recognizes also SAP130, a nuclear protein, that is released by dead or dying cells. Transduces signals through an ITAM-containing adapter protein, Fc receptor gamma chain /FCER1G. Induces secretion of inflammatory cytokines through a pathway that depends on SYK, CARD9 and NF-kappa-B. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 23.6 kDa |
AA Sequence : | TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Clec4e C-type lectin domain family 4, member e [ Mus musculus ] |
Official Symbol | CLEC4E |
Synonyms | CLEC4E; C86253; Mincle; Clecsf9; |
Gene ID | 56619 |
mRNA Refseq | NM_019948 |
Protein Refseq | NP_064332 |
UniProt ID | Q9R0Q8 |
◆ Recombinant Proteins | ||
CLEC4E-2160HF | Recombinant Full Length Human CLEC4E Protein, GST-tagged | +Inquiry |
CLEC4E-1444R | Recombinant Rat CLEC4E Protein | +Inquiry |
Clec4e-284M | Active Recombinant Mouse Clec4e protein, Fc-tagged | +Inquiry |
CLEC4E-679HFL | Recombinant Full Length Human CLEC4E Protein, C-Flag-tagged | +Inquiry |
CLEC4E-2109H | Recombinant Human CLEC4E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC4E-7450HCL | Recombinant Human CLEC4E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC4E Products
Required fields are marked with *
My Review for All CLEC4E Products
Required fields are marked with *
0
Inquiry Basket