Recombinant Human CLEC4E Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CLEC4E-2109H
• Product Overview: CLEC4E MS Standard C13 and N15-labeled recombinant protein (NP_055173) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 25.1 kDa
• AA Sequence: MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CLEC4E C-type lectin domain family 4 member E [ Homo sapiens (human) ]
• Official Symbol: CLEC4E
• Synonyms: CLEC4E; C-type lectin domain family 4, member E; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9, CLECSF9; C-type lectin domain family 4 member E; mincle; C-type lectin superfamily member 9; macrophage-inducible C-type lectin; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 9; MINCLE; CLECSF9
• Gene ID: 26253
• mRNA Refseq: NM_014358
• Protein Refseq: NP_055173
• MIM: 609962
• UniProt ID: Q9ULY5