Recombinant Mouse CHRNA1 Protein (21-230 aa), His-SUMO-tagged

• Cat.No.: CHRNA1-406M
• Product Overview: Recombinant Mouse CHRNA1 Protein (21-230 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Description: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma mbrane.
• Source: E. coli
• Species: Mouse
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 40.5 kDa
• Protein length: 21-230 aa
• AA Sequence: SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Chrna1 cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) [ Mus musculus ]
• Official Symbol: CHRNA1
• Synonyms: CHRNA1; Acra; Achr-1; AI385656; AI608266
• Gene ID: 11435
• mRNA Refseq: NM_007389
• Protein Refseq: NP_031415
• UniProt ID: P04756