Recombinant Human CHRNA1
Cat.No. : | CHRNA1-30388TH |
Product Overview : | Recombinant fragment of Human Nicotinic Acetylcholine Receptor alpha 1 with N terminal proprietary tag, 35.09kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 86 amino acids |
Description : | The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Weight : | 35.090kDa inclusive of tags |
Tissue specificity : | Isoform 1 is only expressed in skeletal muscle. Isoform 2 is constitutively expressed in skeletal muscle, brain, heart, kidney, liver, lung and thymus. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP |
Sequence Similarities : | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-1/CHRNA1 sub-subfamily. |
Gene Name | CHRNA1 cholinergic receptor, nicotinic, alpha 1 (muscle) [ Homo sapiens ] |
Official Symbol | CHRNA1 |
Synonyms | CHRNA1; cholinergic receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) , CHRNA; acetylcholine receptor subunit alpha; |
Gene ID | 1134 |
mRNA Refseq | NM_000079 |
Protein Refseq | NP_000070 |
MIM | 100690 |
Uniprot ID | P02708 |
Chromosome Location | 2q24-q32 |
Pathway | Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; ErbB2/ErbB3 signaling events, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem; |
Function | contributes_to acetylcholine binding; contributes_to acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; contributes_to acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion chann; |
◆ Recombinant Proteins | ||
CHRNA1-2694H | Recombinant Human CHRNA1 protein, His-tagged | +Inquiry |
Chrna1-5380M | Recombinant Mouse Chrna1 protein, His-tagged | +Inquiry |
CHRNA1-5379H | Recombinant Human CHRNA1 protein, His-PDI-tagged | +Inquiry |
CHRNA1-3429M | Recombinant Mouse CHRNA1 Protein | +Inquiry |
CHRNA1-1277H | Recombinant Human CHRNA1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA1-7517HCL | Recombinant Human CHRNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRNA1 Products
Required fields are marked with *
My Review for All CHRNA1 Products
Required fields are marked with *
0
Inquiry Basket