Recombinant Mouse CD74, His-tagged

• Cat.No.: CD74-9493M
• Product Overview: A DNA sequence encoding the extracellular domain (56-215) of mouse CD74 isoform 2 was fused with a polyhistidine tag at the C-terminus.

Specification

• Source: HEK293 cells
• Species: Mouse
• Tag: His
• Form: 25 mM Tris-HCl, pH7.4, 100 mM NaCl, 1 mM DTT
• Molecular Mass: The recombinant mouse CD74 consists of 160 amino acids and has a calculated molecular mass of 18.3KDa. It migrates as an approximately 25kDa band in SDS-PAGE under reducing conditions due to glycosylation.
• AA Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLT RSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGV TRQELGQVTL
• Purity: >95% as determined by SDS-PAGE
• Storage: Store it at +4℃ for short term. For long term storage, store it at -20℃ ~ -70℃. Recommend to aliquot the proteinin to smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.
• Protein length: 56-215 a.a.

Gene Information

• Gene Name: Cd74 CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) [ Mus musculus ]
• Official Symbol: CD74
• Synonyms: CD74; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); H-2 class II histocompatibility antigen gamma chain; HLA-DR-GAMMA; dinucleotide microsatellite; Ia-associated invariant chain; ia antigen-associated invariant chain; MHC class II-associated invariant chain; class II-associated invariant chain peptide; histocompatibility: class II antigens, gamma chain of; invariant polypeptide of major histocompatibility complex, class II antigen-associated; Ii; CLIP; DHLAG; HLADG; Ia-GAMMA
• Gene ID: 16149
• mRNA Refseq: NM_001042605
• Protein Refseq: NP_001036070
• Pathway: Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Tuberculosis, organism-specific biosystem; Tuberculosis, conserved biosystem
• Function: MHC class II protein binding; beta-amyloid binding; contributes_to cytokine binding; cytokine binding; cytokine receptor activity; cytokine receptor activity; nitric-oxide synthase binding; protein binding