Recombinant Human CD74

Cat. No. :	CD74-2229H
Description :	The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Sequence :	MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
MW (kDa) :	18.3
Form :	Liquid
Applications :	Antibody Production; Functional Study; Compound Screening
Storage :	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Tag :	Non

Gene Name	CD74 CD74 molecule, major histocompatibility complex, class II invariant chain [ Homo sapiens ]
Official Symbol	CD74
Synonyms	CD74 molecule, major histocompatibility complex, class II invariant chain; DHLAG; HLADG; Ia-GAMMA; CD74; HLA class II histocompatibility antigen gamma chain; ii; p33; HLA-DR-gamma; MHC HLA-DR gamma chain; Ia-associated invariant chain; gamma chain of class II antigens; ia antigen-associated invariant chain; HLA-DR antigens-associated invariant chain; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); CD74 antigen
Gene ID	972
mRNA Refseq	NM_004355
Protein Refseq	NP_004346
MIM	142790
UniProt ID	P04233
Chromosome Location	5q32
Pathway	Antigen processing and presentation
Function	MHC class II protein binding; beta-amyloid binding; cytokine binding; cytokine receptor activity; identical protein binding