Recombinant Human CD74 Protein, His-tagged

• Cat.No.: CD74-170H
• Product Overview: Recombinant human CD74 protein with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 296
• Description: The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
• Form: Lyophilized
• Molecular Mass: 19.3 kDa
• AA Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CD74 CD74 molecule, major histocompatibility complex, class II invariant chain [ Homo sapiens (human) ]
• Official Symbol: CD74
• Synonyms: CD74; CD74 molecule, major histocompatibility complex, class II invariant chain; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen associated) , DHLAG; HLA class II histocompatibility antigen gamma chain; gamma chain of class II antigens; HLA DR gamma; Ia associated invariant chain; MHC HLA DR gamma chain; p33; HLA-DR-gamma; MHC HLA-DR gamma chain; Ia-associated invariant chain; HLA-DR antigens-associated invariant chain; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); II; DHLAG; HLADG; Ia-GAMMA; FLJ98970
• Gene ID: 972
• mRNA Refseq: NM_001025158
• Protein Refseq: NP_001020329
• MIM: 142790
• UniProt ID: P04233