Recombinant Mouse Cd300c protein, GST-tagged

• Cat.No.: Cd300c-4533M
• Product Overview: Recombinant Mouse Cd300c protein(A2A7V7)(22-188aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Mouse
• Tag: GST
• Protein length: 22-188aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 45.8 kDa
• AASequence: HFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPH
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Cd300c CD300C antigen [ Mus musculus ]
• Official Symbol: Cd300c
• Synonyms: CD300C; CD300C antigen; CMRF35-like molecule 6; CLM-6; CMRF-35-like molecule 6; CD300 antigen-like family member C; Clm6
• Gene ID: 387565
• mRNA Refseq: NM_199225
• Protein Refseq: NP_954695