Recombinant Mouse Cd300c protein, GST-tagged
Cat.No. : | Cd300c-4533M |
Product Overview : | Recombinant Mouse Cd300c protein(A2A7V7)(22-188aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 22-188aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPH |
Gene Name | Cd300c CD300C antigen [ Mus musculus ] |
Official Symbol | Cd300c |
Synonyms | CD300C; CD300C antigen; CMRF35-like molecule 6; CLM-6; CMRF-35-like molecule 6; CD300 antigen-like family member C; Clm6; |
Gene ID | 387565 |
mRNA Refseq | NM_199225 |
Protein Refseq | NP_954695 |
◆ Recombinant Proteins | ||
CD300C-3087M | Active Recombinant mouse CD300C Protein, mIgG2A-tagged | +Inquiry |
CD300C-7729H | Recombinant Human CD300C | +Inquiry |
CD300C-02H | Active Recombinant Human CD300C Protein, Fc-Tagged | +Inquiry |
CD300C-577H | Recombinant Human CD300C Protein, Fc-tagged | +Inquiry |
CD300C-173H | Recombinant Human CD300C, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD300C-2096HCL | Recombinant Human CD300C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd300c Products
Required fields are marked with *
My Review for All Cd300c Products
Required fields are marked with *
0
Inquiry Basket