Recombinant Mouse Ccr1 Full Length Transmembrane protein, His-tagged

• Cat.No.: Ccr1-2945M
• Product Overview: Recombinant Mouse Ccr1 protein(P51675)(1-355aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Source: In vitro E. coli expression system
• Species: Mouse
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.7 kDa
• Protein length: 1-355aa
• AA Sequence: MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Ccr1 chemokine (C-C motif) receptor 1 [ Mus musculus ]
• Official Symbol: Ccr1
• Synonyms: CCR1; chemokine (C-C motif) receptor 1; C-C chemokine receptor type 1; CCR-1; CC-CKR-1; RANTES-R; C-C CKR-1; MIP-1 alphaR; MIP-1alpha-R; MIP-1 alpha R; chemokine (C-C) receptor 1; macrophage inflammatory protein 1-alpha receptor; Cmkbr1; Mip-1a-R
• Gene ID: 12768
• mRNA Refseq: NM_009912
• Protein Refseq: NP_034042