Recombinant Human CCR1 Protein, GST-Tagged
Cat.No. : | CCR1-0686H |
Product Overview : | Human CCR1 partial ORF (NP_001286.1, 256 a.a. - 355 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 256-355 a.a. |
Description : | This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1). Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, and susceptibility to virus and parasite. This gene and other chemokine receptor genes, including CCR2, CCRL2, CCR3, CCR5 and CCXCR1, are found to form a gene cluster on chromosome 3p. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | NLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCR1 chemokine (C-C motif) receptor 1 [ Homo sapiens ] |
Official Symbol | CCR1 |
Synonyms | CCR1; chemokine (C-C motif) receptor 1; CMKBR1, SCYAR1; C-C chemokine receptor type 1; CD191; CKR 1; MIP1aR; CCR-1; CC-CKR-1; RANTES-R; C-C CKR-1; MIP-1alpha-R; LD78 receptor; RANTES receptor; macrophage inflammatory protein 1-alpha receptor; CKR1; CKR-1; HM145; CMKBR1; SCYAR1; |
Gene ID | 1230 |
mRNA Refseq | NM_001295 |
Protein Refseq | NP_001286 |
MIM | 601159 |
UniProt ID | P32246 |
◆ Recombinant Proteins | ||
CCR1-1036H | Recombinant Human CCR1 Protein (Gln265-Leu281), N-GST tagged | +Inquiry |
CCR1-0686H | Recombinant Human CCR1 Protein, GST-Tagged | +Inquiry |
CCR1-3011M | Recombinant Mouse CCR1 Protein | +Inquiry |
CCR1-532R | Recombinant Rhesus Macaque CCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCR1-2997HF | Recombinant Full Length Human CCR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR1-7698HCL | Recombinant Human CCR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCR1 Products
Required fields are marked with *
My Review for All CCR1 Products
Required fields are marked with *
0
Inquiry Basket