Recombinant Human CCR1 Protein, GST-Tagged

Cat.No. : CCR1-0686H
Product Overview : Human CCR1 partial ORF (NP_001286.1, 256 a.a. - 355 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 256-355 a.a.
Description : This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1). Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, and susceptibility to virus and parasite. This gene and other chemokine receptor genes, including CCR2, CCRL2, CCR3, CCR5 and CCXCR1, are found to form a gene cluster on chromosome 3p. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : NLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCR1 chemokine (C-C motif) receptor 1 [ Homo sapiens ]
Official Symbol CCR1
Synonyms CCR1; chemokine (C-C motif) receptor 1; CMKBR1, SCYAR1; C-C chemokine receptor type 1; CD191; CKR 1; MIP1aR; CCR-1; CC-CKR-1; RANTES-R; C-C CKR-1; MIP-1alpha-R; LD78 receptor; RANTES receptor; macrophage inflammatory protein 1-alpha receptor; CKR1; CKR-1; HM145; CMKBR1; SCYAR1;
Gene ID 1230
mRNA Refseq NM_001295
Protein Refseq NP_001286
MIM 601159
UniProt ID P32246

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCR1 Products

Required fields are marked with *

My Review for All CCR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon