Recombinant Human CCR1 protein, His-SUMO-tagged

• Cat.No.: CCR1-6213H
• Product Overview: Recombinant Human CCR1 protein(P32246)(306-355aa), fused with N-terminal His-SUMO tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-SUMO
• Protein length: 306-355aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.9 kDa
• AASequence: ERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CCR1 chemokine (C-C motif) receptor 1 [ Homo sapiens ]
• Official Symbol: CCR1
• Synonyms: CCR1; chemokine (C-C motif) receptor 1; CMKBR1, SCYAR1; C-C chemokine receptor type 1; CD191; CKR 1; MIP1aR; CCR-1; CC-CKR-1; RANTES-R; C-C CKR-1; MIP-1alpha-R; LD78 receptor; RANTES receptor; macrophage inflammatory protein 1-alpha receptor; CKR1; CKR-1; HM145; CMKBR1; SCYAR1
• Gene ID: 1230
• mRNA Refseq: NM_001295
• Protein Refseq: NP_001286
• MIM: 601159
• UniProt ID: P32246