Recombinant Mouse BMP8B Protein (261-399 aa), His-SUMO-tagged

• Cat.No.: BMP8B-2692M
• Product Overview: Recombinant Mouse BMP8B Protein (261-399 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 261-399 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.7 kDa
• AA Sequence: TARPLKKKQLNQINQLPHSNKHLGILDDGHGSHGREVCRRHELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIIPKVCCVPTELSAISLLYYDRNNNVILRRERNMVVQACGCH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Bmp8b bone morphogenetic protein 8b [ Mus musculus ]
• Official Symbol: BMP8B
• Synonyms: BMP8B; bone morphogenetic protein 8b; bone morphogenetic protein 8B; BMP-8B; Op3
• Gene ID: 12164
• mRNA Refseq: NM_007559
• Protein Refseq: NP_031585
• UniProt ID: P55105