Recombinant Human BMP8B

• Cat.No.: BMP8B-27490TH
• Product Overview: Recombinant fragment of Human BMP8 with a N terminal proprietary tag; Predicted MW 35.42 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 89 amino acids
• Description: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible bone inductive activity.
• Molecular Weight: 35.420kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV
• Sequence Similarities: Belongs to the TGF-beta family.

Gene Information

• Gene Name: BMP8B bone morphogenetic protein 8b [ Homo sapiens ]
• Official Symbol: BMP8B
• Synonyms: BMP8B; bone morphogenetic protein 8b; BMP8, bone morphogenetic protein 8 (osteogenic protein 2); bone morphogenetic protein 8B; OP 2; osteogenic protein 2
• Gene ID: 656
• mRNA Refseq: NM_001720
• Protein Refseq: NP_001711
• MIM: 602284
• Uniprot ID: P34820
• Chromosome Location: 1p35-p32
• Pathway: Hedgehog signaling pathway, organism-specific biosystem; Hedgehog signaling pathway, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem
• Function: cytokine activity; growth factor activity