Recombinant Mouse B2M Protein, Fc-tagged

• Cat.No.: B2M-01M
• Product Overview: Recombinant Mouse B2M Protein, fused to Fc-tag, was expressed in E. coli.

Specification

• Description: Predicted to enable MHC class II protein complex binding activity and protein homodimerization activity. Involved in learning or memory; modulation of age-related behavioral decline; and negative regulation of cell differentiation. Acts upstream of or within several processes, including antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent; cellular response to iron(III) ion; and protein refolding. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system; early conceptus; genitourinary system; hemolymphoid system gland; and retina. Used to study hemochromatosis and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in arthritis; familial visceral amyloidosis; immunodeficiency 43; and inflammatory bowel disease.
• Source: E. coli
• Species: Mouse
• Tag: Fc
• Form: 50mM Tris, 300mM NaCl, pH 8.5.
• Molecular Mass: 37.1 kDa
• AA Sequence: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM
• Purity: > 90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.19mg/ml

Gene Information

• Gene Name: B2m beta-2 microglobulin [ Mus musculus (house mouse) ]
• Official Symbol: B2m
• Synonyms: Ly-m11; beta2m; beta2-m
• Gene ID: 12010
• mRNA Refseq: NM_009735
• Protein Refseq: NP_033865
• UniProt ID: P01887