Recombinant Mouse ARHGEF2 Protein, C-Flag-tagged
Cat.No. : | ARHGEF2-05M |
Product Overview : | Recombinant Mouse ARHGEF2 Protein, fused to Flag-tag at C-terminus, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Flag |
Description : | Activates Rho-GTPases by promoting the exchange of GDP for GTP. May be involved in epithelial barrier permeability, cell motility and polarization, dendritic spine morphology, antigen presentation, leukemic cell differentiation, cell cycle regulation, innate immune response, and cancer. Binds Rac-GTPases, but does not seem to promote nucleotide exchange activity toward Rac-GTPases. May stimulate instead the cortical activity of Rac. Inactive toward CDC42, TC10, or Ras-GTPases. Forms an intracellular sensing system along with NOD1 for the detection of microbial effectors during cell invasion by pathogens. Involved in innate immune signaling transduction pathway promoting cytokine IL6/interleukin-6 and TNF-alpha secretion in macrophage upon stimulation by bacterial peptidoglycans; acts as a signaling intermediate between NOD2 receptor and RIPK2 kinase. Contributes to the tyrosine phosphorylation of RIPK2 through Src tyrosine kinase leading to NF-kappaB activation by NOD2. Overexpression activates Rho-, but not Rac-GTPases, and increases paracellular permeability (By similarity). Involved in neuronal progenitor cell division and differentiation. Involved in the migration of precerebellar neurons. |
Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol. |
Molecular Mass : | 111.9 kDa |
AA Sequence : | MSRIESLTRARIDRSKEQATKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSITAKEALICPT CNVTIHNRCKDTLANCTKVKQKQQKAALLRNNTALQSVSLRSKTTTRERPTSAIYPSDSFRQSLLGSRRG LSSLSLAKSVSTTNIAGHFNDESPLGLRQILSQSTDSLNMRNRTLSVESLIDEGVEVFYNELMSDFEMDE KDFEADSWSLAVDSSFLQQHKKEVMKKQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGL FPCVDELSDIHTRFLNQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGSNAEQMRKTYSEFCSRHTKAL KLYKELYARDKRFQQFIRKMTRSAVLKRHGVQECILLVTQRITKYPVLINRILQNSHGVEEEYQDLASAL GLVKELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPGKGPFGRDELLRRKLIHEGCLLWKTATGRFK DVLLLLMTDVLVFLQEKDQKYIFTSLDKPSVVSLQNLIVRDIANQAKGMFLISSGPPEMYEVHAASRDDR TTWIRVIQQSVRLCPSREDFPLIETEDKAYLRRIKTKLQQKNQALVELLQKNVELFAEMVHFQALKAGFV GMPPPALPRGLFRLESFESLRGERLLKDALREVEGLKDLLLGPCVDLPTTSREPALPLDSDSGSCPGVTA NGEARTFNGSIELCRADSDSSQKDRNGNQLRSPQEEVLQPLINLYGLLHGLQAVVVQQERLMEALFPEGP ERWEKLSRANSRDGEAGRAAVASVTPEKQATELALLQRQHTLLQEELRRCQRLGEERATEAGSLEARLRE SEQARALLEREAEEIRRQLAALGQNEPLPAEAPWARRPLDPRRRSLPAGDALYLSFNPPQPSRGHDRLDL PVTVRSLHRPFDDREAQELGSPEDRLQDSSDPDTGSEEEVSSRLSPPHSPRDFTRMQDIPEETESRDGEP TASES myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage : | Store at -80 centigrade after receiving vials. |
Concentration : | >0.05 μg/μL as determined by microplate BCA method. |
Use/Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Gene Name | Arhgef2 Rho/Rac guanine nucleotide exchange factor 2 [ Mus musculus (house mouse) ] |
Official Symbol | ARHGEF2 |
Synonyms | GEF; Lfc; P40; GEFH1; LFP40; Lbcl1; GEF-H1; mKIAA0651; AA408978; Rho/Rac guanine nucleotide exchange factor 2; ARHGEF2 |
Gene ID | 16800 |
mRNA Refseq | NM_008487.4 |
Protein Refseq | NP_032513.3 |
UniProt ID | Q60875 |
◆ Recombinant Proteins | ||
ARHGEF2-12HFL | Recombinant Full Length Human ARHGEF2 Protein, C-Flag-tagged | +Inquiry |
ARHGEF2-1103HF | Recombinant Full Length Human ARHGEF2 Protein, GST-tagged | +Inquiry |
ARHGEF2-1682H | Recombinant Human ARHGEF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARHGEF2-05M | Recombinant Mouse ARHGEF2 Protein, C-Flag-tagged | +Inquiry |
Arhgef2-1297M | Recombinant Mouse Arhgef2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGEF2-8732HCL | Recombinant Human ARHGEF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGEF2 Products
Required fields are marked with *
My Review for All ARHGEF2 Products
Required fields are marked with *
0
Inquiry Basket