Recombinant Malus Domestica (Apple) Mal d 1 protein, His-tagged

• Cat.No.: Mald1-01H
• Product Overview: Recombinant Malus Domestica (Apple) Mal d 1 protein with N-terminal His6 fusion tag was expressed in E. coli.

Specification

• Species: Malus Domestica
• Source: E.coli
• Tag: His
• ProteinLength: 180
• Description: MALD1 is a ribonuclease and a heat-sensitive allergen which is a member of the pathogenesis-related protein class. MALD1 shares homologous IgE epitopes with major birch pollen allergen Bet v 1 and Cor a 1 from hazelnut pollen.
• Form: Buffered aqueous solution
• Molecular Mass: 19.7 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSHYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN
• Purity: >90% by SDS-PAGE
• Applications: 1. Binds IgE type human antibodies.
  2. Immunodot test with positive/negative sera panels.
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.52 mg/ml
• Storage Buffer: Solution in 50 mM Tris, 0.3M NaCl, pH 8.0

Gene Information

• Gene Name: Mal d1
• Official Symbol: Mal d1
• Synonyms: Major allergen Mal d 1, Ypr10 protein, MALD1, ypr10, Mal d 1.0108
• Gene ID: 103425641
• mRNA Refseq: Z72427.1
• Protein Refseq: CAA96536.1
• UniProt ID: Q43551