Recombinant Malus Domestica MALD1 Protein (2-159 aa), His-tagged

• Cat.No.: MALD1-2071M
• Product Overview: Recombinant Malus Domestica (Apple) (Pyrus malus) MALD1 Protein (2-159 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Allergen. Protein Description: Full Length of Mature Protein.

Specification

• Species: Malus Domestica
• Source: Yeast
• Tag: His
• ProteinLength: 2-159 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 19.5 kDa
• AA Sequence: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: MALD1; Allergen Mal d I Allergen: Mal d 1
• UniProt ID: P43211