Recombinant Human ZNF581 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZNF581-2845H
• Product Overview: ZNF581 MS Standard C13 and N15-labeled recombinant protein (NP_057619) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: May be involved in transcriptional regulation.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22 kDa
• AA Sequence: MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZNF581 zinc finger protein 581 [ Homo sapiens (human) ]
• Official Symbol: ZNF581
• Synonyms: ZNF581; zinc finger protein 581; FLJ22550; HSPC189
• Gene ID: 51545
• mRNA Refseq: NM_016535
• Protein Refseq: NP_057619
• UniProt ID: Q9P0T4