Recombinant Human ZNF581 protein, T7-tagged

• Cat.No.: ZNF581-183H
• Product Overview: Recombinant human ZNF581 (197 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: T7
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFMLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQG VPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHS IHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
• Protein length: 197 a.a.

Gene Information

• Gene Name: ZNF581 zinc finger protein 581 [ Homo sapiens ]
• Official Symbol: ZNF581
• Synonyms: ZNF581; zinc finger protein 581; FLJ22550; HSPC189
• Gene ID: 51545
• mRNA Refseq: NM_016535
• Protein Refseq: NP_057619
• UniProt ID: Q9P0T4
• Chromosome Location: 19
• Function: DNA binding; metal ion binding; zinc ion binding