Recombinant Human ZNF581 protein, His-SUMO-tagged

• Cat.No.: ZNF581-3782H
• Product Overview: Recombinant Human ZNF581 protein(Q9P0T4)(1-197aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-197aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38 kDa
• AA Sequence: MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ZNF581 zinc finger protein 581 [ Homo sapiens ]
• Official Symbol: ZNF581
• Synonyms: ZNF581; zinc finger protein 581; FLJ22550; HSPC189
• Gene ID: 51545
• mRNA Refseq: NM_016535
• Protein Refseq: NP_057619
• UniProt ID: Q9P0T4