Recombinant Human XAF1 Protein, GST-tagged

• Cat.No.: XAF1-227H
• Product Overview: Human BIRC4BP partial ORF ( NP_059993.2, 202 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: X-linked inhibitor of apoptosis (XIAP; MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3; MIM 600636). XIAP has 3 BIR domains and a C-terminal RING zinc finger that possesses E3 ubiquitin ligase (see MIM 601623) activity. XAF1 antagonizes the anticaspase activity of XIAP and may be important in mediating apoptosis resistance in cancer cells (Liston et al., 2001 [PubMed 11175744]).
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: QTSTMEKDVRPKTRSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: XAF1 XIAP associated factor 1 [ Homo sapiens ]
• Official Symbol: XAF1
• Synonyms: XAF1; XIAP associated factor 1; XIAP-associated factor 1; BIRC4BP; HSXIAPAF1; XIAPAF1; BIRC4 binding protein; BIRC4-binding protein
• Gene ID: 54739
• mRNA Refseq: NM_017523
• Protein Refseq: NP_059993
• MIM: 606717
• UniProt ID: Q6GPH4