Recombinant Human WWTR1 protein, GST-tagged

• Cat.No.: WWTR1-3635H
• Product Overview: Recombinant Human WWTR1 protein(160 - 294 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 160 - 294 aa
• AA Sequence: NQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: WWTR1 WW domain containing transcription regulator 1 [ Homo sapiens ]
• Official Symbol: WWTR1
• Synonyms: WWTR1; WW domain containing transcription regulator 1; WW domain-containing transcription regulator protein 1; DKFZp586I1419; TAZ; transcriptional coactivator with PDZ-binding motif; transcriptional co-activator with PDZ-binding motif; FLJ27004; FLJ45718
• Gene ID: 25937
• mRNA Refseq: NM_001168278
• Protein Refseq: NP_001161750
• MIM: 607392
• UniProt ID: Q9GZV5