Recombinant Human WNT6 Protein, GST-tagged
| Cat.No. : | WNT6-12H |
| Product Overview : | Human WNT6 full-length ORF ( NP_006513.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Form : | Liquid |
| Molecular Mass : | 66.1 kDa |
| AA Sequence : | MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | WNT6 wingless-type MMTV integration site family, member 6 [ Homo sapiens ] |
| Official Symbol | WNT6 |
| Synonyms | WNT6; wingless-type MMTV integration site family, member 6; protein Wnt-6 |
| Gene ID | 7475 |
| mRNA Refseq | NM_006522 |
| Protein Refseq | NP_006513 |
| MIM | 604663 |
| UniProt ID | Q9Y6F9 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT6 Products
Required fields are marked with *
My Review for All WNT6 Products
Required fields are marked with *
0
Inquiry Basket
