Recombinant Human WNT6 Protein, GST-tagged

Cat.No. : WNT6-12H
Product Overview : Human WNT6 full-length ORF ( NP_006513.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : Liquid
Molecular Mass : 66.1 kDa
AA Sequence : MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name WNT6 wingless-type MMTV integration site family, member 6 [ Homo sapiens ]
Official Symbol WNT6
Synonyms WNT6; wingless-type MMTV integration site family, member 6; protein Wnt-6
Gene ID 7475
mRNA Refseq NM_006522
Protein Refseq NP_006513
MIM 604663
UniProt ID Q9Y6F9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WNT6 Products

Required fields are marked with *

My Review for All WNT6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon