Recombinant Full Length Human WNT6 Protein, GST-tagged

• Cat.No.: WNT6-6263HF
• Product Overview: Human WNT6 full-length ORF ( NP_006513.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of this gene is present on chromosome 14.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Form: Liquid
• Molecular Mass: 66.1 kDa
• Protein length: 365 amino acids
• AA Sequence: MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: WNT6 wingless-type MMTV integration site family, member 6 [ Homo sapiens ]
• Official Symbol: WNT6
• Synonyms: WNT6; wingless-type MMTV integration site family, member 6; protein Wnt-6
• Gene ID: 7475
• mRNA Refseq: NM_006522
• Protein Refseq: NP_006513
• MIM: 604663
• UniProt ID: Q9Y6F9