Recombinant Human WNT5A, StrepII-tagged

• Cat.No.: WNT5A-206H
• Product Overview: Purified, full-length human recombinant WNT5A protein (amino acids 36-380, 345 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 38.8 kDa. (Accession NP_003353.2; UniProt P41221)

Specification

• Description: The WNT family consists of structurally related signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This protein is a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. It is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Protein length: 36-380, 345 a.a.
• AA Sequence: FAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRH RRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDN IDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFR KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGE LMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: WNT5A wingless-type MMTV integration site family, member 5A [ Homo sapiens ]
• Official Symbol: WNT5A
• Synonyms: WNT5A; wingless-type MMTV integration site family, member 5A; protein Wnt-5a; hWNT5A; WNT 5A protein; WNT-5A protein
• Gene ID: 7474
• mRNA Refseq: NM_001256105
• Protein Refseq: NP_001243034
• MIM: 164975
• UniProt ID: P41221
• Chromosome Location: 3p21-p14
• Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem
• Function: cytokine activity; frizzled binding; frizzled-2 binding; protein domain specific binding; receptor agonist activity; receptor binding; receptor tyrosine kinase-like orphan receptor binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding