Recombinant Human WNT5A, GST-tagged

Cat.No. : WNT5A-2052H
Product Overview : Recombinant Human WNT5A (201 a.a. - 300 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants.
Molecular Mass : 36.74 kDa
Sequence : ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
Purification : Glutathione Sepharose 4 Fast Flow
Storage buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note : Best use within three months from the date of receipt of this protein.
OfficialSymbol : WNT5A
Gene Name WNT5A wingless-type MMTV integration site family, member 5A [ Homo sapiens ]
Synonyms WNT5A; wingless-type MMTV integration site family, member 5A; protein Wnt-5a; hWNT5A; WNT 5A protein; WNT-5A protein
Gene ID 7474
mRNA Refseq NM_001256105
Protein Refseq NP_001243034
MIM 164975
UniProt ID P41221
Chromosome Location 3p21-p14
Pathway Basal cell carcinoma; Class B/2 (Secretin family receptors); DNA damage response (only ATM dependent); GPCR ligand binding; HTLV-I infection
Function cytokine activity; frizzled binding; frizzled-2 binding; protein domain specific binding; receptor agonist activity; receptor tyrosine kinase-like orphan receptor binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WNT5A Products

Required fields are marked with *

My Review for All WNT5A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon