Recombinant Human WNT5A, GST-tagged
Cat.No. : | WNT5A-2052H |
Product Overview : | Recombinant Human WNT5A (201 a.a. - 300 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 36.74 kDa |
Sequence : | ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV |
Purification : | Glutathione Sepharose 4 Fast Flow |
Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Note : | Best use within three months from the date of receipt of this protein. |
OfficialSymbol : | WNT5A |
Gene Name | WNT5A wingless-type MMTV integration site family, member 5A [ Homo sapiens ] |
Synonyms | WNT5A; wingless-type MMTV integration site family, member 5A; protein Wnt-5a; hWNT5A; WNT 5A protein; WNT-5A protein |
Gene ID | 7474 |
mRNA Refseq | NM_001256105 |
Protein Refseq | NP_001243034 |
MIM | 164975 |
UniProt ID | P41221 |
Chromosome Location | 3p21-p14 |
Pathway | Basal cell carcinoma; Class B/2 (Secretin family receptors); DNA damage response (only ATM dependent); GPCR ligand binding; HTLV-I infection |
Function | cytokine activity; frizzled binding; frizzled-2 binding; protein domain specific binding; receptor agonist activity; receptor tyrosine kinase-like orphan receptor binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding |
◆ Recombinant Proteins | ||
WNT5A-11H | Active Recombinant Human/Mouse Wnt-5a Protein, Biotinylated | +Inquiry |
WNT5A-195HFL | Recombinant Full Length Human WNT5A Protein, C-Flag-tagged | +Inquiry |
Wnt5a-65R | Recombinant Rat Wnt5a Protein, His-tagged | +Inquiry |
WNT5A-2052H | Recombinant Human WNT5A, GST-tagged | +Inquiry |
WNT5A-2474H | Recombinant Human WNT5A Full Length Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT5A-293HCL | Recombinant Human WNT5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT5A Products
Required fields are marked with *
My Review for All WNT5A Products
Required fields are marked with *
0
Inquiry Basket