Recombinant Human UNG Protein, C-Myc/DDK-Tagged

• Cat.No.: UNG-02H
• Product Overview: Recombinant Human UNG Protein, C-Myc/DDK-Tagged was expressed in HEK293T cell

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases.
• Molecular Mass: 34.5 kDa
• AA Sequence: MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQ
  LDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM
  CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL
  LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSP
  LSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80°C.
• Concentration: >50 ug/mL as determined by microplate BCA method
• Storage Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Gene Information

• Gene Name: UNG uracil DNA glycosylase [ Homo sapiens (human) ]
• Official Symbol: UNG
• Synonyms: DGU; UDG; UNG1; UNG2; HIGM4; HIGM5; UNG15
• Gene ID: 7374
• mRNA Refseq: NM_080911.3
• Protein Refseq: NP_550433
• MIM: 191525
• UniProt ID: P13051