Recombinant Human ULBP1 protein, His-tagged
Cat.No. : | ULBP1-3378H |
Product Overview : | Recombinant Human ULBP1 protein(26-103 aa), fused to His tag, was expressed in E. coli. |
Availability | March 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-103 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ULBP1 UL16 binding protein 1 [ Homo sapiens ] |
Official Symbol | ULBP1 |
Synonyms | ULBP1; UL16 binding protein 1; NKG2D ligand 1; RAET1I; N2DL-1; NKG2DL1; alcan-beta; UL16-binding protein 1; retinoic acid early transcript 1I; |
Gene ID | 80329 |
mRNA Refseq | NM_025218 |
Protein Refseq | NP_079494 |
MIM | 605697 |
UniProt ID | Q9BZM6 |
◆ Recombinant Proteins | ||
Ulbp1-769M | Active Recombinant Mouse Ulbp1 Protein, His-tagged | +Inquiry |
ULBP1-05H | Recombinant Human ULBP1 Protein (26-215), C-Fc/Avi-tagged | +Inquiry |
ULBP1-3249HF | Recombinant Human ULBP1 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
ULBP1-270H | Recombinant Human UL16 binding protein 1 Protein, His tagged | +Inquiry |
ULBP1-3591H | Recombinant Human ULBP1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ULBP1-2440HCL | Recombinant Human ULBP1 cell lysate | +Inquiry |
ULBP1-2641HCL | Recombinant Human ULBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ULBP1 Products
Required fields are marked with *
My Review for All ULBP1 Products
Required fields are marked with *
0
Inquiry Basket