Recombinant Human UBE2W Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UBE2W-3408H
• Product Overview: UBE2W MS Standard C13 and N15-labeled recombinant protein (NP_060769) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a nuclear-localized ubiquitin-conjugating enzyme (E2) that, along with ubiquitin-activating (E1) and ligating (E3) enzymes, coordinates the addition of a ubiquitin moiety to existing proteins. The encoded protein promotes the ubiquitination of Fanconi anemia complementation group proteins and may be important in the repair of DNA damage. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 17.3 kDa
• AA Sequence: MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UBE2W ubiquitin conjugating enzyme E2 W [ Homo sapiens (human) ]
• Official Symbol: UBE2W
• Synonyms: UBE2W; ubiquitin-conjugating enzyme E2W (putative); ubiquitin-conjugating enzyme E2 W; FLJ11011; ubiquitin-protein ligase W; ubiquitin carrier protein W; ubiquitin-conjugating enzyme 16; probable ubiquitin-conjugating enzyme E2 W; UBC16; UBC-16; hUBC-16
• Gene ID: 55284
• mRNA Refseq: NM_018299
• Protein Refseq: NP_060769
• MIM: 614277
• UniProt ID: Q96B02